PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E02900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26489.2 Da    PI: 7.8031
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E02900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.4e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+g+l+e+s+
  Pahal.E02900.1  9 KRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGRLFEFST 59
                    79***********************************************96 PP

2K-box96.83.2e-328717314100
           K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     + s +qe+ kLk +ie Lq++qR+llGedL++Ls+keL+qLe+q+e slk+iRs Kn+ +l+q+ el+ ke++lq+ nk+Lr+k++e
  Pahal.E02900.1  87 ELSNYQEYLKLKTRIEFLQTTQRNLLGEDLGPLSIKELEQLENQIEISLKHIRSSKNQQMLDQLFELKCKEQQLQDSNKDLRRKIQE 173
                     456789*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.207161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-32277IPR002100Transcription factor, MADS-box
CDDcd002653.35E-41278No hitNo description
PRINTSPR004048.3E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.64387177IPR002487Transcription factor, K-box
PfamPF014867.0E-2789172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGRLFEFSTS  60
SCMYKTLERY RSCNFASEAS SAPIEAELSN YQEYLKLKTR IEFLQTTQRN LLGEDLGPLS  120
IKELEQLENQ IEISLKHIRS SKNQQMLDQL FELKCKEQQL QDSNKDLRRK IQEISEENVL  180
HLTCQDLGPS GSNAIPNSKI TDASQELLRI AVCDPSLHIG YQAYIDHLSK E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D1e-258017110101Developmental protein SEPALLATA 3
4ox0_C1e-258017110101Developmental protein SEPALLATA 3
4ox0_B1e-258017110101Developmental protein SEPALLATA 3
4ox0_A1e-258017110101Developmental protein SEPALLATA 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6616030.0JN661603.1 Setaria italica MADS5-like protein (OSM5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964768.11e-151PREDICTED: MADS-box transcription factor 5-like
SwissprotA2Y9P01e-133MADS5_ORYSI; MADS-box transcription factor 5
SwissprotQ0DEB81e-133MADS5_ORYSJ; MADS-box transcription factor 5
TrEMBLK3XZ681e-151K3XZ68_SETIT; Uncharacterized protein
STRINGSi007226m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22213264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.11e-73MIKC_MADS family protein